PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G29410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 214aa    MW: 22013 Da    PI: 8.8896
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G29410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.5e-44411401100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdP+yG+vg i++lqqq+e l+a+l
  ORUFI03G29410.1  41 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSLQQQVEALQAQL 134
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  ORUFI03G29410.1 135 ALAQAE 140
                      **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74740141IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4341138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MRDVVVAVGG GTKAASRQQG QGGVTLAAAA AGSGSGSAAS PCAACKLLRR RCAAGCVFAP  60
YFPPGEPHKF ANVHKVFGAS NVSKLLQEIP VQHRGDAVSS LVYEANARVR DPIYGCVGAI  120
SSLQQQVEAL QAQLALAQAE MVRLRMSNDY IGRRLRARGC GGGGGGGGGS TTTTTGSPSS  180
MSSPAKTAEP EPLCKPTPEL DMVVDQPDFG FWSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1391740.0AC139174.3 Oryza sativa chromosome 3 BAC OSJNBb0065L20 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629600.11e-155PREDICTED: LOB domain-containing protein 4
SwissprotQ8LBW37e-59LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D9ZI361e-155A0A0D9ZI36_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NZ401e-155A0A0E0NZ40_ORYRU; Uncharacterized protein
TrEMBLA2XKA01e-155A2XKA0_ORYSI; Putative uncharacterized protein
TrEMBLQ75GP01e-155Q75GP0_ORYSJ; Expressed protein
STRINGBGIOSGA013249-PA1e-155(Oryza sativa Indica Group)
STRINGLOC_Os03g45750.11e-155(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-35LOB domain-containing protein 4